bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1410_orf1 Length=135 Score E Sequences producing significant alignments: (Bits) Value 33169.AGOS_AAR071W 145 4e-34 > 33169.AGOS_AAR071W Length=2231 Score = 145 bits (366), Expect = 4e-34, Method: Compositional matrix adjust. Identities = 67/109 (61%), Positives = 83/109 (76%), Gaps = 0/109 (0%) Query 27 PLAEYVKLHGGDRPIRRILIANNGMAATKAIASMRQWAFETFGDPNLLTFVVMASSEDLE 86 PL +YV+LHGG I +ILIANNG+AA K I S+R+WA+ETFGD ++ FVVMA+ EDLE Sbjct 45 PLRDYVRLHGGHTVISKILIANNGIAAVKEIRSVRKWAYETFGDGKVVQFVVMATPEDLE 104 Query 87 ANSEFIKKADFIVPVPGGPSRENYGNVSLICDIAVKQKVDAVWPGWGHA 135 AN+E+I+ AD V VPGG + NY NV LI D+A + VDAVW GWGHA Sbjct 105 ANTEYIRMADQYVEVPGGTNNNNYANVDLIVDVAERADVDAVWAGWGHA 153 Lambda K H 0.318 0.135 0.421 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22597853330 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40