bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1349_orf2 Length=143 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0172 134 1e-30 > 5833.PF11_0172 Length=455 Score = 134 bits (336), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 66/138 (47%), Positives = 94/138 (68%), Gaps = 0/138 (0%) Query 6 PPVFKPIFAFISDSYPLYGSRRKPYMIAFSLLEGLGFIMLGTFPTHVLTALISLFTISIS 65 P + KP+ A I+DS+ ++G RRKPY+ FSL + L F+ L V+ A + LF IS+ Sbjct 86 PFILKPVIALITDSFSIFGMRRKPYLFLFSLFQSLNFLALAFLNLSVIQASLILFFISLC 145 Query 66 AAFCSAVAEALVVETTAGRSMDQSAENVSDFITAKAVGSLIVAYLSGYLLEKTSKQSIFL 125 A+FC+ VAEALVVE++ G++ Q V++FI +KA+GSL VAY SGY LEK ++ IF+ Sbjct 146 ASFCTTVAEALVVESSMGQTYSQGTNKVTEFIASKAIGSLSVAYFSGYFLEKMPREYIFI 205 Query 126 ATSIFPLFIAFITFFMTD 143 ATSIFPL I+ F+ + Sbjct 206 ATSIFPLIISLSCLFLKE 223 Lambda K H 0.327 0.138 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22654093455 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40