bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1310_orf1 Length=108 Score E Sequences producing significant alignments: (Bits) Value 3702.AT5G10100.1 91.3 7e-18 > 3702.AT5G10100.1 Length=369 Score = 91.3 bits (225), Expect = 7e-18, Method: Composition-based stats. Identities = 48/104 (46%), Positives = 67/104 (64%), Gaps = 8/104 (7%) Query 2 LETPNLLDEVQYVRYKLADKSLCIFLDYDGTLTPIVADPREAKMSPAFRKTLKKLARVFP 61 ++ P+ L++ + + K + +FLDYDGTL+PIV DP +A MS R+T+KKLA+ FP Sbjct 92 MQHPSALEKFEQIMEASRGKQIVMFLDYDGTLSPIVDDPDKAFMSSKMRRTVKKLAKCFP 151 Query 62 VAIVTGRRLETIRSFVGLADAPGRRALMYAASHGFDID--AAGF 103 AIVTGR ++ + +FV LA+ L YA SHG DI A GF Sbjct 152 TAIVTGRCIDKVYNFVKLAE------LYYAGSHGMDIKGPAKGF 189 Lambda K H 0.326 0.141 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22451482439 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40