bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1287_orf2 Length=120 Score E Sequences producing significant alignments: (Bits) Value 5833.PF08_0112b 142 4e-33 > 5833.PF08_0112b Length=1053 Score = 142 bits (357), Expect = 4e-33, Method: Composition-based stats. Identities = 71/123 (57%), Positives = 90/123 (73%), Gaps = 4/123 (3%) Query 1 GVAAAEE---EMDVTELWLHNMIEGIEFVLGSISNTASYLRLWALSLAHQQLSCIFFEKT 57 G A EE E +++E+W+ +IE IEF+LG ISNTASYLRLWALSLAHQQLS +FFE+T Sbjct 917 GGGAGEENHHEENISEIWIEQLIETIEFILGLISNTASYLRLWALSLAHQQLSFVFFEQT 976 Query 58 VGLAFQPGLSPSQMAFKLIFFFPAFLCITIFVMVAMEALECFLHALRLQWVEFQNKFYKG 117 + + + S + LI F F +TI V++ M+ LECFLH+LRLQWVEFQNKFYKG Sbjct 977 ILNSLKRN-SFMSVLINLILFSQLFSILTIAVILCMDTLECFLHSLRLQWVEFQNKFYKG 1035 Query 118 DGV 120 DG+ Sbjct 1036 DGI 1038 Lambda K H 0.330 0.140 0.440 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23080484097 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40