bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1284_orf1 Length=116 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_1010 147 9e-35 > 5807.cgd2_1010 Length=586 Score = 147 bits (371), Expect = 9e-35, Method: Compositional matrix adjust. Identities = 65/115 (56%), Positives = 86/115 (74%), Gaps = 0/115 (0%) Query 2 ELGAKLSRVDWQRVELVPFEKNFYVEHPEIAQMPPEEADRIRTDHEITIIAGVNVPKPCP 61 + G +L ++DW L+PFEKNFY EH ++ + E+ D+IR + +ITIIAG NVPKP Sbjct 109 KFGDRLGKLDWGSQNLIPFEKNFYHEHESVSSLSNEQVDQIRKERKITIIAGENVPKPIT 168 Query 62 TFEHTSFPSYLLDAISAAGFQKPTPIQLQGWPIALSGRDMIGIAETGSGKTLAFL 116 +F + FP++L+DA+ GF +PT IQ+QGWP+ALSG DMIGIAETGSGKTL FL Sbjct 169 SFVTSGFPNFLVDALYRTGFTEPTAIQVQGWPVALSGHDMIGIAETGSGKTLGFL 223 Lambda K H 0.318 0.137 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22619469984 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40