bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1280_orf2 Length=186 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0571 106 4e-22 > 5833.PF14_0571 Length=334 Score = 106 bits (264), Expect = 4e-22, Method: Compositional matrix adjust. Identities = 50/161 (31%), Positives = 105/161 (65%), Gaps = 2/161 (1%) Query 26 SLLDFTPLSAPQKRHVSKIYAALTVNVLLTAVGVYAQLRWVSLPTFLSLLLSIGCVFGLT 85 ++++F+PL+ ++ H+ KIY L + +++A+ Y + + +P F++ ++S+ C F L Sbjct 109 NIMNFSPLTNEERNHLIKIYGLLAMGTIVSALSCYVDIYYFKVPRFIASIISLVCSF-LL 167 Query 86 SSSQKAHAESQMLTKERALCSGGFGVLNGMLIANYLHAIHFYVGPQVIPTAFFASVAVFF 145 +SS +H + +K+R + G G+LI++Y++ ++ Y+ P ++P AFF S+++F Sbjct 168 ASSCNSHYQLVDTSKKRLVYFAGISSSIGVLISDYINYVN-YLNPSILPLAFFGSLSIFC 226 Query 146 CFSAAALVAKQRSYLYLGSLLGAALTYLSIASLVNIFLRAQ 186 CFS AA+ +K R ++LG++L A +Y+++ S +N F+R++ Sbjct 227 CFSLAAIFSKNRISIFLGAVLCAVCSYMALISFMNFFIRSK 267 Lambda K H 0.328 0.138 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 40752393066 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40