bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1279_orf1 Length=212 Score E Sequences producing significant alignments: (Bits) Value 5833.PFE1245w 99.8 5e-20 > 5833.PFE1245w Length=704 Score = 99.8 bits (247), Expect = 5e-20, Method: Composition-based stats. Identities = 49/108 (45%), Positives = 59/108 (54%), Gaps = 1/108 (0%) Query 101 FYKTKMCDREEGRPCSFPAVCSFAHSPAELRPVYDLTRTRMCPQQQEKGFCSSLRCRYSH 160 FYKTKMC C C FAHS EL P+ DL+ T +CP ++ G C + +C Y+H Sbjct 24 FYKTKMCPWFFSGRCDRGMECLFAHSQGELNPIPDLSFTSLCPLTKKSGLCKNEKCSYAH 83 Query 161 SPSELRSTSTFYKTQLCIGFQTPSGCRHGEMCRHAHGLKELRPSPAPL 208 S ELR T YKT C F C E CRHAH ++ELRP P L Sbjct 84 SVCELRPTGDLYKTAPCTKFLR-GKCNAEEHCRHAHFVEELRPLPGNL 130 Lambda K H 0.330 0.140 0.464 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 54290949897 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40