bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1265_orf2 Length=108 Score E Sequences producing significant alignments: (Bits) Value 3702.AT1G34220.1 72.0 5e-12 > 3702.AT1G34220.1 Length=649 Score = 72.0 bits (175), Expect = 5e-12, Method: Composition-based stats. Identities = 40/107 (37%), Positives = 59/107 (55%), Gaps = 9/107 (8%) Query 2 WKATKLATLFHGRRWPRSLKMAISRARMCTNRLQNSIRLQRKEIAGFLREGREEGARLKG 61 +KA K TL LK+ I R ++ NR + I+ R+EIA L G+E AR++ Sbjct 12 FKAAKCKTL---------LKLTIPRIKLIRNRREAQIKQMRREIAKLLETGQEATARIRV 62 Query 62 EHLLREYRLERAMEILVTVCELLISRLSYLATERTCPPDLDSPIHTL 108 EH++RE ++ A EIL CEL+ RL + +R CP DL I ++ Sbjct 63 EHIIREEKMMAAQEILELFCELIAVRLPIIEAQRECPLDLKEAISSV 109 Lambda K H 0.325 0.137 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22451482439 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40