bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1257_orf2 Length=177 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0425 255 3e-67 > 5833.PF14_0425 Length=369 Score = 255 bits (652), Expect = 3e-67, Method: Compositional matrix adjust. Identities = 121/177 (68%), Positives = 144/177 (81%), Gaps = 1/177 (0%) Query 2 DGEQAPMGLDGLSERCKRYYEAGARFAKWRAVLQIDEAKGKPSEQSISEVAYGLARYAAI 61 D E++ GLDGL+ERCK YY+AGARFAKWR VL ID AKGKP++ SI E A+GLARYA+I Sbjct 125 DEEKSTQGLDGLAERCKEYYKAGARFAKWRTVLVIDTAKGKPTDLSIHETAWGLARYASI 184 Query 62 CQKNKLVPIVEPEILTDGSHDIRHCAAVTERVLSHVFRELQKQKVLLEGALLKPNMVTPG 121 CQ+N+LVPIVEPEIL DG H I CA VT++VLS VF+ LQ+ VLLEGALLKPNMVT G Sbjct 185 CQQNRLVPIVEPEILADGPHSIEVCAVVTQKVLSCVFKALQENGVLLEGALLKPNMVTAG 244 Query 122 AQ-GPKATPQEIALFTVRALSRTVPPALPGVMFLSGGQSEEEASLNLDAMNRMGPHP 177 + K T Q++ TVR L RTVPPALPGV+FLSGGQSEEEAS+NL+++N +GPHP Sbjct 245 YECTAKTTTQDVGFLTVRTLRRTVPPALPGVVFLSGGQSEEEASVNLNSINALGPHP 301 Lambda K H 0.317 0.133 0.388 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35195248557 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40