bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1247_orf2 Length=128 Score E Sequences producing significant alignments: (Bits) Value 7955.ENSDARP00000037664 126 2e-28 > 7955.ENSDARP00000037664 Length=849 Score = 126 bits (316), Expect = 2e-28, Method: Compositional matrix adjust. Identities = 65/108 (60%), Positives = 80/108 (74%), Gaps = 0/108 (0%) Query 21 HTCTVQEVLEYHETSLESGLPAEVVAERLERFGPNELQHEEGKSLFQLILEQFQDLLVRI 80 HT TV+EVL Y + +GL +E + + ER+GPNEL EEGKSL++L+LEQF+DLLVRI Sbjct 5 HTKTVEEVLGYFSVNETTGLSSEQLRKSRERWGPNELPAEEGKSLWELVLEQFEDLLVRI 64 Query 81 LLAAAVVSFVLAVVEGGEGGLAAYVEPLVILIILFLNAAVXVWQESNA 128 LL AA +SF LA E GEG + A+VEP VIL+IL NA V VWQE NA Sbjct 65 LLLAACISFTLAWFEEGEGTITAFVEPFVILLILIANAIVGVWQERNA 112 Lambda K H 0.320 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22424899233 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40