bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1234_orf2 Length=138 Score E Sequences producing significant alignments: (Bits) Value 5833.PFF1325c 105 4e-22 > 5833.PFF1325c Length=449 Score = 105 bits (262), Expect = 4e-22, Method: Composition-based stats. Identities = 40/85 (47%), Positives = 54/85 (63%), Gaps = 0/85 (0%) Query 51 ATRKEGASPFECCICMDEIHDPVVTRCGHLFCWGCLHLWLQQSGDCPICKAAVSADTVTP 110 AT E + FEC IC D++ DPVVT+CGHLFCW CL W++++ DCP+CKA VS + V P Sbjct 279 ATENESRNTFECNICFDDVRDPVVTKCGHLFCWLCLSAWIKKNNDCPVCKAEVSKENVIP 338 Query 111 IYGRSSSPKSHAHTRHFSSETPPSR 135 +YGR + H + + P R Sbjct 339 LYGRGKNSSDHKYAQPEEPRPTPKR 363 Lambda K H 0.315 0.125 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22344559178 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40