bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1231_orf1 Length=142 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL8P1.122 90.1 2e-17 > 5833.MAL8P1.122 Length=238 Score = 90.1 bits (222), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 44/132 (33%), Positives = 72/132 (54%), Gaps = 4/132 (3%) Query 12 IRSLADLRETQDEPHDDSSGTSSFAGGERSGLAIQNPSAAF-PSATRGAAPAGSRRVTLY 70 IRSL+DL++ + ++ + + GG++SGL +QN F + + P R +TLY Sbjct 4 IRSLSDLKK---DDKKNNERVAHYTGGQKSGLEVQNSDDDFVQNLFKSKLPENCRHITLY 60 Query 71 ANGFTVDDGPFREFGRRENDVFIEELKAGVAPKELQQGGRQVHVLLDDRHEEKYTPPPPP 130 NGF VDDG FR+ EN F+ ++AG+ PKE + ++V + D+ + YT Sbjct 61 KNGFIVDDGEFRDLEIEENKKFMANIEAGILPKEFASKDKTMNVAIKDKSNQIYTKKKTK 120 Query 131 QYVLFGGEGQSL 142 + L+ G+G L Sbjct 121 EQELYKGQGVKL 132 Lambda K H 0.317 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22741008115 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40