bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1201_orf2 Length=153 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_4840 89.4 3e-17 > 5807.cgd8_4840 Length=2409 Score = 89.4 bits (220), Expect = 3e-17, Method: Composition-based stats. Identities = 45/142 (31%), Positives = 73/142 (51%), Gaps = 22/142 (15%) Query 2 WNDLHANFSNLTGPGVFWRESCLFSQGQSLRQRLQKQQQESGGVHPIELIQTDPDWAIFD 61 W + ++ S+ GP W E+ +F + + Q + P++ I Sbjct 1004 WMQMTSSSSSFIGPSPLWFENSIFRFPAEIEFNVYDQDP----IKPVKFI---------- 1049 Query 62 WERECGYTCNSTRVFEPVEQEAERKAVTVWAEAEARTFVEKYLMYPKNFEKIAACLDGKT 121 Y + +V P +QE R T+W +E R F+EKYLMYPK+F +IA+ ++ KT Sbjct 1050 ------YINKNNQVINPTDQERNRN--TIWTYSEIRMFIEKYLMYPKDFRRIASFMEYKT 1101 Query 122 TRDCVDFYYRFKFKFGLKRKLQ 143 +DC+DFYY++K+ G KR L+ Sbjct 1102 IKDCIDFYYKYKYTLGFKRILR 1123 Lambda K H 0.321 0.136 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23213563385 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40