bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1196_orf2 Length=189 Score E Sequences producing significant alignments: (Bits) Value 7227.CG10913-PA 99.8 4e-20 > 7227.CG10913-PA Length=374 Score = 99.8 bits (247), Expect = 4e-20, Method: Compositional matrix adjust. Identities = 64/196 (32%), Positives = 102/196 (52%), Gaps = 23/196 (11%) Query 2 VSERLNCDAVSTDFEDSAAAAAAINAFVEGKTKGHIKHIVPASALTPSSRMVLVNALYFK 61 + E+ + +A S +F + AAA AINA+V KT+G I +V A + + ++R+VL+NAL+FK Sbjct 111 IKEQYHSEAESINFALNDAAAQAINAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFK 170 Query 62 APWASPFSPHRTATGPFYVNDTRTGRSEVQQVKFMQQRLEEDFGLFESDKVKVLSMPYAD 121 WA FS RT F+V G E ++ +M Q+ + ++G FE L MPY D Sbjct 171 GSWAHKFSEERTEEDIFWV-----GEEEQVKINYMNQKAKFNYGFFEDLGCTALEMPYQD 225 Query 122 PRCRLYLFLP---NSIAAFEQELQQKPETTEELVSLVDNTPSSDV-------VLDLSLPL 171 +++ LP I A ++L+ T LV L D +V +D SL Sbjct 226 SDLSMFVLLPQERTGIYALAEKLK-----TVNLVDLADKLTVEEVHVKFPKFKVDYSL-- 278 Query 172 IKLAAERNQVGLVDVY 187 +LA + Q+G+ ++ Sbjct 279 -ELAEKLKQLGITKMF 293 Lambda K H 0.317 0.131 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 41818451300 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40