bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1182_orf1 Length=131 Score E Sequences producing significant alignments: (Bits) Value 3702.AT2G39260.1 70.9 1e-11 > 3702.AT2G39260.1 Length=1181 Score = 70.9 bits (172), Expect = 1e-11, Method: Composition-based stats. Identities = 36/127 (28%), Positives = 73/127 (57%), Gaps = 2/127 (1%) Query 5 LLNRISQATTAQQIDQIAADFFLERLNAKQNRSELIMHILFVAETNVQCMPCCARLLAIL 64 LL R+ + IDQ+ ++ LN+K NR +L+ + V T+++ + +R++A L Sbjct 470 LLQRLPGCVSRDLIDQLTVEYCY--LNSKTNRKKLVKALFNVPRTSLELLAYYSRMVATL 527 Query 65 RKLLKEETNQALELLQSKWRQLADDCDPTKVEERVRVLRFVCELIKLKLLPPGLLLNCCS 124 +K+ + +++L+ ++ L D +E ++R +RF+ EL K K++P GL+ +C Sbjct 528 ASCMKDIPSMLVQMLEDEFNSLVHKKDQMNIETKIRNIRFIGELCKFKIVPAGLVFSCLK 587 Query 125 SWLEDFT 131 + L++FT Sbjct 588 ACLDEFT 594 Lambda K H 0.326 0.136 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22935578866 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40