bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1172_orf1 Length=161 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0236 120 1e-26 > 5833.PF14_0236 Length=1781 Score = 120 bits (302), Expect = 1e-26, Method: Composition-based stats. Identities = 50/74 (67%), Positives = 63/74 (85%), Gaps = 1/74 (1%) Query 67 KLELRKTSLCKYWLKGKCENEDCNFAHGEHELQSTVGVFKTTICKYWRQ-GCCYSGELCR 125 K ELRKTS+CKYW+KG C N +CNFAHGEHEL+ T GV+KTTICK+W++ G C SG CR Sbjct 223 KYELRKTSICKYWIKGICANVECNFAHGEHELKYTFGVYKTTICKHWKKNGMCSSGIHCR 282 Query 126 HAHGDADLRPENLP 139 HAHG+++L+P+NLP Sbjct 283 HAHGESELQPKNLP 296 Lambda K H 0.321 0.135 0.432 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 26764363279 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40