bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1168_orf2 Length=164 Score E Sequences producing significant alignments: (Bits) Value 5833.PFB0435c 65.9 4e-10 > 5833.PFB0435c Length=912 Score = 65.9 bits (159), Expect = 4e-10, Method: Composition-based stats. Identities = 36/138 (26%), Positives = 64/138 (46%), Gaps = 1/138 (0%) Query 28 SWLQRQRRRGWYSSTTLVYSTLFGAVVGASNFTTYWQQLQIWRSSMFFLPYLLFLFTVGL 87 +WL Q G++ ++ +G N T W + W +F +PY+L F V Sbjct 421 NWLNCQLNNGYWLERFSLFLLGLTIAIGVGNIETIWFLMSTWHGVIFIVPYILCYFFVCH 480 Query 88 PTLQLELVLGNLLRGAAIKQNTQLSRWLVGLGILQVLTSLSFVIITAV-LSGQLLIYFVS 146 P L EL +G L+R + +L + +G L VL L I + + + IY ++ Sbjct 481 PILTFELYIGQLVRTSTPFIFYRLLKPCASVGFLMVLACLMNSYINSYRTASEYFIYLIN 540 Query 147 SFSRPQPWQVTVSDMELC 164 SF + PW+++ +++ C Sbjct 541 SFKKDLPWKLSKEEIKFC 558 Lambda K H 0.324 0.137 0.433 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 28631644438 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40