bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1123_orf1 Length=167 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL13P1.182 135 7e-31 > 5833.MAL13P1.182 Length=282 Score = 135 bits (339), Expect = 7e-31, Method: Compositional matrix adjust. Identities = 63/162 (38%), Positives = 102/162 (62%), Gaps = 0/162 (0%) Query 3 AEEFIKEARIDLQMPLHCIDCRAKIREAILSGQTDEAIRQIGFIDPNLLNADAEVTFLLH 62 A+EF KE+ + MP++ + R I+ I++ + +EAI I +D +L ++ F L Sbjct 50 AKEFQKESNVKPDMPINTVKIRYLIQNEIMNNKIEEAIEHINNLDKGILKKHKDLVFFLK 109 Query 63 KQQLLRLIEAGDPEEAIDFAQQRLAPCVKECPHLLPQLEEVMALLAFSDLSCPEAQRLIG 122 KQQLL+LI + EAI ++QQ LA VKE P L+ ++++VM L+A+ D + EA+ LI Sbjct 110 KQQLLKLILNNNINEAIIYSQQELASYVKEKPSLINEIDDVMMLMAYQDFNNEEAKNLIQ 169 Query 123 GMEQREETARRIDEAILDLYRIEQESALELLTKKVLFSQGCL 164 +E+++ T +RID+ IL+ Y ++ ES LE + K V F+Q L Sbjct 170 KIEKKKNTLKRIDDIILNYYNVDSESTLEYMVKNVFFTQNVL 211 Lambda K H 0.322 0.138 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30498925597 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40