bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1116_orf2 Length=121 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0293 127 8e-29 > 5833.PF11_0293 Length=136 Score = 127 bits (320), Expect = 8e-29, Method: Compositional matrix adjust. Identities = 62/116 (53%), Positives = 90/116 (77%), Gaps = 1/116 (0%) Query 1 QEINKARRAGDAVETEKKFLGGQNRTTKANLI-PNAKKVEEDTGDYHIDRVSTDFSRALA 59 ++I++AR+ G VE EKK+ GG+N+++K NLI N K+E++T ++ IDRV+ FSRAL Sbjct 21 KDIHEARKLGIDVEVEKKYFGGKNKSSKGNLIIENKAKIEQETENFKIDRVTPAFSRALQ 80 Query 60 EARRNKGMTQAQLAQAINEKPSVVSEYESGKAIPNGVILQKMSRALGVQLPKCKQK 115 +AR +K +TQAQLA+ +NE SV+ EYE+GKAIPN VI+QK+++ LGV LP K+K Sbjct 81 QARISKKLTQAQLARLVNESESVIKEYENGKAIPNNVIIQKLNKVLGVNLPSPKKK 136 Lambda K H 0.310 0.126 0.336 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22998535989 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40