bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1109_orf1 Length=289 Score E Sequences producing significant alignments: (Bits) Value 5833.MAL13P1.118 86.7 7e-16 > 5833.MAL13P1.118 Length=1139 Score = 86.7 bits (213), Expect = 7e-16, Method: Composition-based stats. Identities = 43/160 (26%), Positives = 87/160 (54%), Gaps = 3/160 (1%) Query 4 SATTIVVRGALNPRFIAPSFVVIRVVTYFVLAFFLFLGRYAAEMHLRQTFLGWLDTRRRV 63 ++++I++ G+ P F+ +VV R++ Y L FL++G Y +E+ +R F L ++ Sbjct 575 NSSSIILVGSAKPDFVPEIYVVFRILAYTTLCIFLYIGSYTSELQIRYVFYNLLVAGYKL 634 Query 64 ERLESDLKRQRSRGGVSTSLEHLVQLVKQMQELNHLSLSSSAAEGSRPELRLQLQESRAL 123 +++ESD+K + S +ST +E L+ ++K E + L + + + + Sbjct 635 DKIESDMKNKTSNKKISTGIEDLINMLK---ECTKVILELENETDTNFNVHTKTSYCSNI 691 Query 124 LQQCLSILCTTTNLYAVNFGPLDNIEHLDIIQALLNDKNA 163 L+QCLS L + NLY +++ L+N E+ I+A ++ + Sbjct 692 LEQCLSTLTKSDNLYNIDYNVLENPENKKFIEAYVSKSKS 731 Lambda K H 0.315 0.126 0.354 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 97212566178 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40