bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1106_orf2 Length=95 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_4350 93.2 2e-18 > 5807.cgd2_4350 Length=1281 Score = 93.2 bits (230), Expect = 2e-18, Method: Composition-based stats. Identities = 47/93 (50%), Positives = 61/93 (65%), Gaps = 0/93 (0%) Query 2 LIQVLKANQTLGSLRAYFQAFRSRDDELKASTAESKDVVYVVFTFFLLASYSTALNFSCD 61 L+ +LK N+ G R F AFRSRDDELKAST+E+ D++ V TF LL Y NFS D Sbjct 401 LVSILKDNRDWGRARISFSAFRSRDDELKASTSENSDILLVGLTFTLLFFYVGVANFSFD 460 Query 62 LYRSKLFSSLMGFFAAFMGLGAGMGIVCYMKVA 94 LY+ K +S L G FAA +GL +GMG++ V+ Sbjct 461 LYKMKTYSGLAGLFAALLGLASGMGLMSIFGVS 493 Lambda K H 0.330 0.138 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22621220430 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40