bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1104_orf2 Length=157 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL0275w 121 7e-27 > 5833.PFL0275w Length=1785 Score = 121 bits (303), Expect = 7e-27, Method: Composition-based stats. Identities = 56/102 (54%), Positives = 77/102 (75%), Gaps = 1/102 (0%) Query 53 RLTVRVARDRAHRIDSKLFDARLIQHGLPWDLGRHQHSLLHLPHSSVSLSHLLFYKEQQR 112 ++ +++ +DR HRIDS +FD+ ++ + LPWD GRH SL+H+PHSSVSLSHLLF K + Sbjct 649 KVILKLYQDRTHRIDSHVFDSSVLPNRLPWDGGRHAKSLIHMPHSSVSLSHLLFVKAEN- 707 Query 113 GSLHLVDLGSTIGTMAKVCGVQPLQSGDLIHIGDRVEVSVEI 154 ++ +VD GSTIGTM KV L+ GD+IHIGDR+EV+V I Sbjct 708 NNIGVVDCGSTIGTMIKVNNYHVLKEGDVIHIGDRLEVTVSI 749 Lambda K H 0.319 0.132 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 24996413160 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40