bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1101_orf2 Length=239 Score E Sequences producing significant alignments: (Bits) Value 3702.AT5G04430.2 63.5 5e-09 > 3702.AT5G04430.2 Length=334 Score = 63.5 bits (153), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 36/114 (31%), Positives = 66/114 (57%), Gaps = 3/114 (2%) Query 102 GAPTANSATAAAATAATAAAAAADTCYCKLLVSNHLAGIIIGQAGSEIRTLKTLTGAKIV 161 G+P + + ++ A +A + + LVSN AG +IG+ GS I + +GA+I Sbjct 10 GSPEELAKRSPEPHDSSEADSAEKPTHIRFLVSNAAAGSVIGKGGSTITEFQAKSGARIQ 69 Query 162 LSPHGMYFPGTSDRVAAIEGAETAVLHVVDWLIDKLQTA--AEDAANPLQQQQQ 213 LS + +FPGT+DR+ I G+ V++ ++ ++DKL + AED N ++ +++ Sbjct 70 LSRNQEFFPGTTDRIIMISGSIKEVVNGLELILDKLHSELHAED-GNEVEPRRR 122 Lambda K H 0.309 0.119 0.324 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 69865650655 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40