bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1084_orf1 Length=182 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0155 147 1e-34 > 5833.PF14_0155 Length=572 Score = 147 bits (371), Expect = 1e-34, Method: Composition-based stats. Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 1/124 (0%) Query 58 VVFEGPLVDFMDFHAPGSVFSASLTAYSAGGALKAFELMTGAQQWRIKKAQENARYLRHL 117 +V +++F+DFH G+VFSA L AY AGGALKAFEL+ Q WRI+K + N +YLR+ Sbjct 407 IVASDEVIEFLDFHCIGNVFSAPLPAYCAGGALKAFELID-TQPWRIQKLKFNTKYLRNG 465 Query 118 IETGDGHWPADYPEELKYEVEGMPCTTVIPVVFPNSPQRMFRITTCLLDKGFYCAAAAFP 177 ++TG GHWP DYPE KY +EG T+VIPV+FPN P R+F+I LL + +A +P Sbjct 466 LKTGMGHWPKDYPESYKYIIEGDDATSVIPVIFPNDPDRLFKICNLLLKMNWMISAVVYP 525 Query 178 ACPL 181 ACPL Sbjct 526 ACPL 529 Lambda K H 0.327 0.140 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 38282551062 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40