bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1057_orf1 Length=188 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_1180 107 2e-22 > 5807.cgd7_1180 Length=227 Score = 107 bits (267), Expect = 2e-22, Method: Compositional matrix adjust. Identities = 72/183 (39%), Positives = 111/183 (60%), Gaps = 27/183 (14%) Query 2 KSAAFINHKPFHPGNYQNQEKVWLAEQKLKEEQKKEKELEERRREEVKIEELRRALR--- 58 K++ F+NHK FHPGN +N+EKVWLAE+KLKEE++K++EL ++R++E +IEELRR LR Sbjct 9 KASVFLNHKHFHPGNSKNREKVWLAEEKLKEEERKQEELLKKRKKEWEIEELRRDLRQSN 68 Query 59 GEAKAALQLQKK-EEAVSPAEELRRKAKEAARLQALQRKHQEAQNRLKKLSKSTLYDEDA 117 + K L++Q + EE + +++L + AR K KS LY+ED Sbjct 69 KKVKNQLKVQSEVEEVIDKSKQLHDVLVDKARAN-------------KSWVKSELYEEDV 115 Query 118 FTQGHTSVFGSLYSKEENKWGYRCCGSLDRSAPCTANQGDDENRTKKRKNKNAMSTRAAD 177 F H+SV+GS Y KWG++CC +L RS+ C+A K+K+ +S + + Sbjct 116 FLGNHSSVWGSYYDPNVKKWGFKCCKNLKRSSVCSA----------YNKSKSQISNSSYN 165 Query 178 TTV 180 T++ Sbjct 166 TSI 168 Lambda K H 0.308 0.123 0.340 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 41203474075 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40