bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1048_orf1 Length=178 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd3_2740 103 2e-21 > 5807.cgd3_2740 Length=542 Score = 103 bits (257), Expect = 2e-21, Method: Composition-based stats. Identities = 57/161 (35%), Positives = 86/161 (53%), Gaps = 5/161 (3%) Query 22 LDARSKCFTDEHAFVLRM-----ASTLFPFPPKAPWTCLYASWKHGTSFSRLCANCFFYS 76 +D S+ + EH +LR AS+ PW LYASWKHG S +RL + YS Sbjct 279 IDDNSRVLSTEHCCILRCQYFGDASSGECLTLFQPWNLLYASWKHGLSLNRLVSLIEGYS 338 Query 77 APMVAVVKTEEGQVLGAIISCELKEGGHNFFGDANTCLFSLEPQLNILRTSGLGRIFIYL 136 + ++ ++KT + + G++ + + KEG + GD L SL P +I+ SG GR F+Y+ Sbjct 339 SNVLLLIKTTDNCIFGSVCTGDWKEGNGKYCGDETCFLTSLRPMFSIIGQSGKGRNFMYI 398 Query 137 HTSNKFHPIGMGFGGQVGAFRFWIGDEMKDCYITKSDCTYS 177 +T F P G+GFGG+ R W+ + KSD TY+ Sbjct 399 NTRYDFSPKGIGFGGEPEYSRLWLDSTLGTGTCLKSDLTYN 439 Lambda K H 0.324 0.139 0.461 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35812709058 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40