bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1006_orf2 Length=156 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_4080 109 3e-23 > 5807.cgd7_4080 Length=451 Score = 109 bits (272), Expect = 3e-23, Method: Compositional matrix adjust. Identities = 57/120 (47%), Positives = 81/120 (67%), Gaps = 4/120 (3%) Query 26 SSSPVKVLNASEFKSQVINSHDLHLVEFYANWCGHCQRFAPEFEKAAKALRGLADVVAVN 85 SSS VKV+N S+ K +++ + + +VEF+A WCGHC+ FAPE+EKAAKAL+G+ VVA++ Sbjct 45 SSSQVKVINGSQLK-KLVKENPVVIVEFFAEWCGHCKAFAPEYEKAAKALKGIVPVVAID 103 Query 86 DETLMQEFGVSGFPTVMIVVGRGGSKPKTFKYEGNRDASSVLEFAVMHIGKLARAGLAGK 145 D++ M E+G+ GFPTV V KPK F G R A SVL A+ + + + L+GK Sbjct 104 DQSDMAEYGIQGFPTVK-VFTEHSVKPKDFT--GPRRAESVLNAALSALKDVTNSRLSGK 160 Lambda K H 0.313 0.128 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 24371502831 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40