bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1004_orf1 Length=107 Score E Sequences producing significant alignments: (Bits) Value 3702.AT1G22180.2 67.0 2e-10 > 3702.AT1G22180.2 Length=314 Score = 67.0 bits (162), Expect = 2e-10, Method: Compositional matrix adjust. Identities = 35/105 (33%), Positives = 61/105 (58%), Gaps = 9/105 (8%) Query 3 PRCTDLYHYT------LYTLEKALRSVCVGSDRDQLVFLVDFAGFRVSQVPSMDVSREVV 56 P C + Y +Y +E A+ + + +++Q+V+L+DF GF +S + S+ VSRE Sbjct 114 PSCQNTKSYKGQIRILVYCMENAI--LNLPDNQEQMVWLIDFHGFNMSHI-SLKVSRETA 170 Query 57 QILNEHYTDILAKAYMLDAPAYLDGHWRIVKLMLHPLTASKVEFV 101 +L EHY + L A + + P + +++VK L P T++KV+FV Sbjct 171 HVLQEHYPERLGLAIVYNPPKIFESFYKMVKPFLEPKTSNKVKFV 215 Lambda K H 0.325 0.137 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22528463995 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40