bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_1002_orf2 Length=97 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd6_3280 121 8e-27 > 5807.cgd6_3280 Length=1030 Score = 121 bits (303), Expect = 8e-27, Method: Composition-based stats. Identities = 47/72 (65%), Positives = 60/72 (83%), Gaps = 0/72 (0%) Query 1 GDDETWNFKWTDCDNNNDCIVAFLRSYEFWFNDILVVCNFSPQAYYRYPVGVPHGGEWQL 60 GDDE+WNF+W DC+N+ DCI+AFLR Y+ W+ND++VVCNFS + Y YP+GVPHG EW + Sbjct 912 GDDESWNFQWVDCENSQDCIIAFLRKYKEWYNDVVVVCNFSSRRYNHYPIGVPHGKEWLV 971 Query 61 LLNSDDWKYAGG 72 +LNSDDWKY G Sbjct 972 MLNSDDWKYGGA 983 Lambda K H 0.322 0.140 0.520 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22472223870 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40