bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0984_orf1 Length=150 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd2_4270 83.6 2e-15 > 5807.cgd2_4270 Length=1257 Score = 83.6 bits (205), Expect = 2e-15, Method: Composition-based stats. Identities = 48/145 (33%), Positives = 78/145 (53%), Gaps = 3/145 (2%) Query 1 PYEEAASSKTLNLVRDVEVSLQNPIPGDVNSAFVSLYVSEPPDVLESVIYSTVGEMIRAP 60 PY A LN+ D+ + NPI D N+A V+ +++ P D+++ IYS++GE++ +P Sbjct 896 PYSNAIHDGILNVSGDIHIKANNPISSDKNNAVVAHFLTPPVDLIDVSIYSSIGEILNSP 955 Query 61 FFDTLRTVNMDGYVASAGVTELPPVSALSTIVQSSVRTPAELEEHVCGFLHLMGGLLAGA 120 F+DTLRT DGYVA A P+ +L VQS+ + L H+ L + + Sbjct 956 FYDTLRTEWQDGYVAFATTKYETPIISLIGAVQSAEKLSETLVCHMFSALKKVSKDVEED 1015 Query 121 L---SPAAFKSKMKWEGRSHLEREQ 142 L S + F+ K++W G S ++ Sbjct 1016 LKEISKSEFEDKIRWFGLSKYSSQK 1040 Lambda K H 0.316 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22764965652 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40