bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0976_orf1 Length=186 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0301 222 6e-57 > 5833.PF13_0301 Length=202 Score = 222 bits (565), Expect = 6e-57, Method: Compositional matrix adjust. Identities = 111/177 (62%), Positives = 135/177 (76%), Gaps = 1/177 (0%) Query 10 ARLEKELQGLQQEREGKNKDDDHDVYAEKWDTDISHWRGRIKGPLDTPYEGGVFILDINI 69 +R KEL LQ+E + K++ ++ A DT+I W G IKGP TPYEGG FILDI I Sbjct 5 SRSSKELLRLQKELKDIEKENVDEIDAHMKDTNIFEWVGFIKGPSGTPYEGGHFILDITI 64 Query 70 PSDYPYNPPKINFVTKVWHPNVSSQTGAICLDILKHEWSPALSIRTALLSIQAMLADPVP 129 P+DYPYNPPKI F TK+WHPN+SSQTGAICLD+LK+EWSPAL+IRTALLSIQA+L+DP P Sbjct 65 PNDYPYNPPKIKFNTKIWHPNISSQTGAICLDVLKNEWSPALTIRTALLSIQALLSDPQP 124 Query 130 TDPQDAEVAKMLIENPDLFKKTARHWTETFA-MNAAESQEDKVKKLREMGFDEETAR 185 DPQDAEVAKM EN L+ KTA WT+TFA + E +ED +KK+ EMGF E+ A+ Sbjct 125 DDPQDAEVAKMYKENYSLYLKTASVWTKTFATVPKLEPREDIIKKITEMGFSEDQAK 181 Lambda K H 0.315 0.132 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 40752393066 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40