bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0971_orf1 Length=170 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_3430 187 1e-46 > 5807.cgd7_3430 Length=637 Score = 187 bits (475), Expect = 1e-46, Method: Composition-based stats. Identities = 79/173 (45%), Positives = 120/173 (69%), Gaps = 6/173 (3%) Query 3 RLRMCRQLIEAVHFLHTEKRLVHRDLKTANLVVDSEYNIRLCDFGKTRSLEQHGKLK--- 59 RL++ RQL +AV+F+H +VHRD+KTAN+++D N++LCDFG+TR++ K Sbjct 413 RLKISRQLCDAVNFIH-HNNMVHRDIKTANIILDRSNNVKLCDFGQTRTMNIATKTSPPG 471 Query 60 --LEDNGGSPRYMAPECFVEGNYVDEKLDLWGLACCLIEILGGPIPFEDIHSNEGVIHAL 117 L++NGGSPRYMAPECF G +DEK D+W +ACCL+EI GGPIPF + SNE VI+A+ Sbjct 472 VVLDENGGSPRYMAPECFYIGRSIDEKSDIWAIACCLLEIFGGPIPFYEYSSNEEVINAI 531 Query 118 LYNRRKPTVPAWFHPVVRSTLDSCFAWNPWERPDTLYIKDVFSKLTPGELNKY 170 + ++KP +P+WFHP + + L CF P++RP + + + + + ++ +Y Sbjct 532 IVEKKKPKIPSWFHPSISNLLSKCFERKPFKRPSSYEVLMILNGINSEDIKEY 584 Lambda K H 0.323 0.142 0.462 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 31617132627 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40