bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0963_orf3 Length=199 Score E Sequences producing significant alignments: (Bits) Value 5833.PFE1370w 154 2e-36 > 5833.PFE1370w Length=458 Score = 154 bits (388), Expect = 2e-36, Method: Compositional matrix adjust. Identities = 73/151 (48%), Positives = 102/151 (67%), Gaps = 0/151 (0%) Query 13 EVVVPESTPAPPLAPAEERELTDEDYEKLAKAKEAATEAAEAGDLNRAVESYTEALLVGN 72 + +V E+ PPLAP + +L+DE E+++ K A E + A+E Y + + G Sbjct 102 DFMVEETIECPPLAPIVDEDLSDEVLEEISNLKIEAAELVQDNKFEEALEKYNKIIAFGK 161 Query 73 PTALLYTRRADVLLKQKRYAAAIRDCDEALKLNPDNARAYRIRGTANRYLGHWKQAHSDI 132 P+A++YT+RA VLL KR A IRDC EAL LN D+A AY++R A R+LG W+ AH+DI Sbjct 162 PSAMIYTKRASVLLSLKRPKACIRDCTEALNLNIDSANAYKVRAKAYRHLGKWECAHADI 221 Query 133 EMGQKIDYDENIWDIQKLVEQKYKIIEEHER 163 E GQKIDYDE++W++QKL+E+KYK I E R Sbjct 222 EQGQKIDYDEDLWEMQKLIEEKYKKIYEKRR 252 Lambda K H 0.309 0.126 0.346 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 47162034073 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40