bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0955_orf1 Length=145 Score E Sequences producing significant alignments: (Bits) Value 6239.C15H9.6.2 228 3e-59 > 6239.C15H9.6.2 Length=661 Score = 228 bits (582), Expect = 3e-59, Method: Compositional matrix adjust. Identities = 112/145 (77%), Positives = 130/145 (89%), Gaps = 1/145 (0%) Query 1 YGLDKKD-EKTILVYDLGGGTFDVSVLVIDNGVFEVHATSGDTHLGGEDFDQRVMDHFLK 59 YGLDKKD E+ ILV+DLGGGTFDVS+L IDNGVFEV AT+GDTHLGGEDFDQRVM++F+K Sbjct 214 YGLDKKDGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIK 273 Query 60 IIQKKFGKDLRKDKSGLQRLRREVERAKRALSSSHQVTVEVEGLVDGEDFSETLTRAKFE 119 + +KK GKDLRKDK +Q+LRREVE+AKRALS+ HQ VE+E L DGEDFSETLTRAKFE Sbjct 274 LYKKKSGKDLRKDKRAVQKLRREVEKAKRALSTQHQTKVEIESLFDGEDFSETLTRAKFE 333 Query 120 ELNADLFQKTLKPVKQVLEDADLKK 144 ELN DLF+ TLKPV++VLED+DLKK Sbjct 334 ELNMDLFRATLKPVQKVLEDSDLKK 358 Lambda K H 0.316 0.137 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22480264135 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40