bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0954_orf1 Length=139 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd4_1210 101 6e-21 > 5807.cgd4_1210 Length=471 Score = 101 bits (252), Expect = 6e-21, Method: Composition-based stats. Identities = 45/87 (51%), Positives = 60/87 (68%), Gaps = 1/87 (1%) Query 53 RKSRWEKSKKSADGSRWGSETDKPFLPPPFIDLPIGMTPLQVDRFLREQRLEELYRKLNN 112 R+SRW K + SRW S +K ++PP + D P GM+ ++D+FLREQRL+EL KL Sbjct 40 RESRWSKVSDGST-SRWKSVYEKEYIPPAYSDFPPGMSNYEIDQFLREQRLDELIYKLQM 98 Query 113 GILEFFDADIRPPSPPPVYDKNGGRVN 139 G +E+ DIR PSPPP+YDKNG R+N Sbjct 99 GEIEYGSPDIREPSPPPIYDKNGSRIN 125 Lambda K H 0.323 0.140 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23001752095 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40