bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0951_orf8 Length=462 Score E Sequences producing significant alignments: (Bits) Value 69293.ENSGACP00000009750 114 5e-24 > 69293.ENSGACP00000009750 Length=5541 Score = 114 bits (286), Expect = 5e-24, Method: Compositional matrix adjust. Identities = 84/217 (38%), Positives = 101/217 (46%), Gaps = 20/217 (9%) Query 42 CRADAHCGEFGAWSEWSATCGSATRYREREGYENPPASGGGLSCLEQNPPKFPKEVETVQ 101 C D + E+ W E S TCG R R R NPPA GG C + EV Sbjct 4487 CPVDGNWSEWSLWEECSRTCGQGNRTRVRTC-SNPPAQHGGKPCEGR-----AVEVIMCS 4540 Query 102 KVPCPVQQQPGPWGNWSDCSATCGGGTRHRERQGYPQEGELHGG--ETLEKQGISVRETE 159 PCPV G W WS CS TCG G + R R G E+ + Q T+ Sbjct 4541 VRPCPVAGNWGSWLPWSPCSETCGKGVQSRLRLCNSPPPAFDGPQCESTDTQ------TQ 4594 Query 160 ACNENPCPVDATCGEWTAYSACTKVCGGGTQERRREPWLDNAQHGGRSCMEQHPEGPVES 219 C E PCPVD W ++ AC+ CGGGT++R R QHGGRSC EG Sbjct 4595 VCKERPCPVDGKWSSWVSWGACSVSCGGGTRQRTRLCASPAPQHGGRSC-----EGNDVL 4649 Query 220 IE-CNTQPCPVDEVVGEWQGWGPCSEQCGGGKQVRYR 255 I+ CN+ CP+ G W WG CS+ C GG+ RYR Sbjct 4650 IDFCNSDLCPISGNWGAWSSWGSCSKTCNGGQMRRYR 4686 Lambda K H 0.311 0.132 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 193928192370 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40