bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0947_orf1 Length=201 Score E Sequences producing significant alignments: (Bits) Value 5833.PFL2250c 162 5e-39 > 5833.PFL2250c Length=735 Score = 162 bits (411), Expect = 5e-39, Method: Composition-based stats. Identities = 72/123 (58%), Positives = 104/123 (84%), Gaps = 0/123 (0%) Query 77 KKVGPGDFVLLHVIGKGSYGKVMLVRFEQDGQLYALKVLLKESLLRRSQVQHTRTERAVL 136 K++ P F L VIG+GSYGKVMLV+ Q+ +LYA+K+L KE++L R+Q++HT+ ER +L Sbjct 396 KRIRPESFNYLKVIGEGSYGKVMLVKHVQNKKLYAMKILRKENILSRNQLEHTKVERNIL 455 Query 137 EAISHPFIVQMHFAFQTPKKLYFVLEYCPGGELFFHLQKEGKFTEDRSRFYAAELLLALE 196 + +SHPFIV+M++AFQT +KLYF+LEYCPGGELFFHL K +F+E+ ++FY++E++LALE Sbjct 456 KCVSHPFIVKMYYAFQTKQKLYFILEYCPGGELFFHLSKLREFSEETAKFYSSEIILALE 515 Query 197 HLH 199 +LH Sbjct 516 YLH 518 Lambda K H 0.318 0.132 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 48387021971 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40