bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0936_orf1 Length=203 Score E Sequences producing significant alignments: (Bits) Value 3702.AT5G52360.1 99.0 8e-20 > 3702.AT5G52360.1 Length=137 Score = 99.0 bits (245), Expect = 8e-20, Method: Compositional matrix adjust. Identities = 52/126 (41%), Positives = 80/126 (63%), Gaps = 12/126 (9%) Query 87 ASGMPVNEDCVTTFNELKLRHAFKWIIFKIDHDEIVVEKKGS--SGAADFSKELPASDCR 144 ASGM V ++C F ELK + +++IIF+ID ++VVEK GS DF+ LP ++CR Sbjct 5 ASGMAVEDECKLKFLELKAKRNYRFIIFRIDGQQVVVEKLGSPQENYDDFTNYLPPNECR 64 Query 145 YAVYD---------EGQRIHFILWSPDCAPVKPRMIYSSSKDALAKKLEGTMATTLEAHE 195 YAVYD + +I FI WSPD + V+ +M+Y+SSKD ++L+G + L+A + Sbjct 65 YAVYDFDFTTAENIQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDG-IQVELQATD 123 Query 196 LSDLSV 201 S++S+ Sbjct 124 PSEMSL 129 Lambda K H 0.326 0.138 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 49612009869 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40