bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0914_orf1 Length=183 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd7_2430 115 7e-25 > 5807.cgd7_2430 Length=460 Score = 115 bits (288), Expect = 7e-25, Method: Compositional matrix adjust. Identities = 62/164 (37%), Positives = 93/164 (56%), Gaps = 11/164 (6%) Query 29 KEALTIRCPEIAEVSNRLRNMFITTPSVTPDAFFVELRMLQVSQDFDAKCRLFVVLSALF 88 K+ LT PEI +V RL N V+P+ FF ELR+LQVSQDFD R V+L+ LF Sbjct 209 KDVLTFESPEIVDVIERLTNFMQKNEEVSPEDFFSELRVLQVSQDFDEFMRFSVLLAVLF 268 Query 89 --KEGLTPEGLDQKMPFVVKCCDSSVRSSDIIYALENFCFESEETQMTGFPYLLQRMYNA 146 K+ + P+ ++P++ K + S+RS+ II E++C E + + +PYL+Q++Y+A Sbjct 269 GLKDPIDPKVFKLRIPYISKAVEGSLRSNAIISIFESYCVEKNPSTLATYPYLIQQLYDA 328 Query 147 ELLEAEDILNYYNAD---------TTDPVTLKCKTFAEPFLQWL 181 ++L + IL YY D +T K K EPF+ WL Sbjct 329 DILSEKVILKYYQKDAPTSWVSGCSTQDTFEKAKKSCEPFVDWL 372 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 38900011563 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40