bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0902_orf1 Length=102 Score E Sequences producing significant alignments: (Bits) Value 7955.ENSDARP00000022096 65.1 5e-10 > 7955.ENSDARP00000022096 Length=309 Score = 65.1 bits (157), Expect = 5e-10, Method: Composition-based stats. Identities = 36/81 (44%), Positives = 50/81 (61%), Gaps = 4/81 (4%) Query 26 IYNIAQVILCGFLVARVFDVWRAEEYSFICNRFNV---PN-TRMAEVTWFFYMLKYVDLL 81 IYN + VIL F+ +F RA YS+IC + PN R+A W++++ K V+ L Sbjct 70 IYNFSMVILNFFIFKELFLAARAANYSYICQPVDYSDDPNEVRVAAALWWYFISKGVEYL 129 Query 82 DTVFMIVRGNWRQVSFLHVYH 102 DTVF I+R + Q+SFLHVYH Sbjct 130 DTVFFILRKKFNQISFLHVYH 150 Lambda K H 0.333 0.142 0.466 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22913371775 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40