bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0887_orf4 Length=190 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0203 62.0 1e-08 > 5833.PF11_0203 Length=1052 Score = 62.0 bits (149), Expect = 1e-08, Method: Composition-based stats. Identities = 52/177 (29%), Positives = 85/177 (48%), Gaps = 22/177 (12%) Query 8 YQLFSDATAQLVDDEVRNLISNQYERVKALLKEKEK-----------KETLTFADLQDCL 56 Y+ S+ A L+D+EVR+LI QY+RVK++L + EK KET+++ D+ C+ Sbjct 852 YRPHSECLAHLIDNEVRSLIETQYKRVKSILMKNEKHVHNLANLLYEKETISYHDIVKCV 911 Query 57 GTRPFPPDAQLAAYINALPTKVNTVGQEEPGVE-RASGDLRRIPTAISGDRNVRD-EKGS 114 G RP+P + ++ A P K + EP +E + D + T+ G+ N D EKG Sbjct 912 GERPYPVKSAYEKFVKANPYKAIS---SEPLLEDKKESDNMKGDTSNIGNVNTNDFEKGH 968 Query 115 TSDKDAAADGHSMQQRKQSIKDTEGSNGDDKEPTDAGKNGGKGKKKRNGKGNAADDD 171 + + + K++ KD N + N K + N GN++ DD Sbjct 969 IKENTKEC---TKENTKENTKDNTKENTKENTKEYTKDN---TKNQYNILGNSSKDD 1019 Lambda K H 0.305 0.128 0.357 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 42433428525 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40