bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0880_orf1 Length=230 Score E Sequences producing significant alignments: (Bits) Value 3702.AT5G18620.2 142 8e-33 > 3702.AT5G18620.2 Length=1072 Score = 142 bits (358), Expect = 8e-33, Method: Compositional matrix adjust. Identities = 85/213 (39%), Positives = 131/213 (61%), Gaps = 7/213 (3%) Query 23 PLTEEEKEERKRLIAEGFRGWARRDLLAFVRGCEMYGRWDLERIATEVEGKSLDDVRRYA 82 PLT EE EE++ L+ EGF W+RRD AF+R CE YGR D++ IA+E+EGK+ ++V RYA Sbjct 830 PLTAEEVEEKELLLEEGFSTWSRRDFNAFIRACEKYGRNDIKSIASEMEGKTEEEVERYA 889 Query 83 AVFWSRLEELSDWRKLLKRIQDGEAVIQRRRELEQVIVRRQQQSDFPWRRLPVNFAAATK 142 VF R +EL+D+ +++K I+ GEA I R+ E+ + I ++ + PW L + + K Sbjct 890 QVFQVRYKELNDYDRIIKNIERGEARISRKDEIMKAIGKKLDRYRNPWLELKIQY-GQNK 948 Query 143 SKSFFAEEEDIFVLNLTTLLGYGNWEKLRSQILRDSTWTGDWFFRSRAPADLGRRAEAII 202 K + EE D F++ + LGYGNW++L++ + DWF +SR +L RR + +I Sbjct 949 GK-LYNEECDRFMICMVHKLGYGNWDELKAAFRTSPLFRFDWFVKSRTTQELARRCDTLI 1007 Query 203 RQLKKE-----EGERFSRGRRRLDMPATKQQSP 230 R ++KE E ER +R ++L AT + P Sbjct 1008 RLIEKENQEFDERERQARKEKKLSKSATPSKRP 1040 Lambda K H 0.321 0.135 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 64397904082 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40