bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0871_orf1 Length=101 Score E Sequences producing significant alignments: (Bits) Value 9615.ENSCAFP00000034118 131 6e-30 > 9615.ENSCAFP00000034118 Length=186 Score = 131 bits (329), Expect = 6e-30, Method: Compositional matrix adjust. Identities = 64/101 (63%), Positives = 80/101 (79%), Gaps = 3/101 (2%) Query 1 VRAERGKDVVIALVGNKTDLSDRRQVSPEEGEQKAREQGILFIETSAKAGHNVKTLFRRL 60 VR ERG DV+I LVGNKTDL+D+RQVS EEGE+KA+E ++FIETSAKAG+NVK LFRR+ Sbjct 89 VRTERGSDVIIMLVGNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRV 148 Query 61 AAALPGLETQQPASDAQMVDVQLNATPQQQDLSRKASGCSC 101 AAALPG+E+ Q S M+D++L PQ+Q +S GCSC Sbjct 149 AAALPGMESTQDRSREDMIDIKLEK-PQEQPVSE--GGCSC 186 Lambda K H 0.313 0.127 0.346 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22990353331 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40