bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0860_orf2 Length=184 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0245 251 8e-66 > 5833.PF11_0245 Length=555 Score = 251 bits (641), Expect = 8e-66, Method: Compositional matrix adjust. Identities = 115/185 (62%), Positives = 145/185 (78%), Gaps = 3/185 (1%) Query 1 PNMIEGAAQADVGVLIISARKGEFETGFEKGGQTREHTLLAKTLGVCQLVVAVNKMDEST 60 PNMI GAAQAD+GVLIISARKGEFETGFE+GGQTREHTLLA+TLG+ QL+VA+NKMD+ T Sbjct 212 PNMISGAAQADIGVLIISARKGEFETGFERGGQTREHTLLARTLGINQLIVAINKMDDPT 271 Query 61 CQWNEERYREIIKKTKPFFQGCGFVLGKNLSYIPISGLGGHNLKEHVSRPGSSCLDTRAA 120 C W+E RY EI KK P+ + CG+ + K++ ++PISGL G NL EHVS S D RA+ Sbjct 272 CNWSESRYEEIQKKITPYIKSCGYNINKDVFFVPISGLTGQNLSEHVSDKNSKIYDPRAS 331 Query 121 WYPADEPTLFELLNTLTPPPRKPNAPLRVPILDGYKDNGVTALGKVEAGTVTFG--MQAI 178 WY +PTLF +LN+L PPP N PLR+P+L+GYKDNG+ A+GK+E+GT+ +G M Sbjct 332 WYDLSKPTLFNILNSLPPPPWDENGPLRIPLLEGYKDNGIIAIGKIESGTL-YGNNMNCT 390 Query 179 LMPSK 183 LMP+K Sbjct 391 LMPNK 395 Lambda K H 0.317 0.136 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 39517472064 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40