bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0855_orf1 Length=176 Score E Sequences producing significant alignments: (Bits) Value 5833.PF13_0133 70.9 2e-11 > 5833.PF13_0133 Length=590 Score = 70.9 bits (172), Expect = 2e-11, Method: Composition-based stats. Identities = 52/198 (26%), Positives = 88/198 (44%), Gaps = 50/198 (25%) Query 18 IAWTSITSKAAYRVQILQMEADGEILGEGEEAFGRTLVDSGTTYSYFPPGVYAAWRRVLN 77 I W +IT K Y ++I ++ G + + +E LVDSG+T+++ P +Y L+ Sbjct 329 IVWQAITRKYYYYIKIYGLDLYGTNIMDKKEL--DMLVDSGSTFTHIPENIYNQINYYLD 386 Query 78 RHCTPSL---------------------------------------FCQREKDGRPCWRI 98 C + C + DG CW+ Sbjct 387 ILCIHDMTNIYEINKRLKLTNESLNKPLVYFEDFKTALKNIIQNENLCIKIVDGVQCWK- 445 Query 99 PSGSFLSL-SLPSIKLTFKEGDVIHWLPQSYLYRRTGGFWCDGLDDNRSQESVLGLSFFK 157 SL +LP++ +T + W P SYLY++ FWC GL+ + + +LGL+FFK Sbjct 446 ------SLENLPNLYITLSNNYKMIWKPSSYLYKKES-FWCKGLEKQVNNKPILGLTFFK 498 Query 158 HKQIVFDRDKNRIGALNA 175 +KQ++FD +N+I + + Sbjct 499 NKQVIFDLQQNQIAFIES 516 Lambda K H 0.319 0.135 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 35336795289 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40