bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0841_orf1 Length=217 Score E Sequences producing significant alignments: (Bits) Value 13616.ENSMODP00000032331 60.1 5e-08 > 13616.ENSMODP00000032331 Length=677 Score = 60.1 bits (144), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 43/141 (30%), Positives = 62/141 (43%), Gaps = 3/141 (2%) Query 79 ISRPRKLSRMTSLAARRKSRLFGVVESLSAMCEQSAKIGTDWSFDCLHFGEIS-RKPLCE 137 IS RKL+ +S +A R FGV + + K W D E+S +PL Sbjct 259 ISGVRKLTHGSSFSAAAIPR-FGVKTDHETLLAKELKDTNKWGLDVFKVAELSGNRPLTA 317 Query 138 IGFAILSPFSLSPEISLHRDVLTAFLEEVTDCYKEN-PYHNALHGATVCHMTLCLLEMLQ 196 I ++I L + D L +L + D Y + YHN++H A V T LL Sbjct 318 IMYSIFQERDLLKTFRIPVDTLVTYLLTLEDHYHADVAYHNSIHAADVAQSTHVLLSTPA 377 Query 197 IREYMSDLEDISACIASLCHD 217 + +DLE ++A AS HD Sbjct 378 LEAVFTDLEILAAIFASAIHD 398 Lambda K H 0.324 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 57341003262 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40