bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0821_orf2 Length=168 Score E Sequences producing significant alignments: (Bits) Value 5833.PF11_0268 73.2 3e-12 > 5833.PF11_0268 Length=596 Score = 73.2 bits (178), Expect = 3e-12, Method: Composition-based stats. Identities = 42/154 (27%), Positives = 71/154 (46%), Gaps = 5/154 (3%) Query 9 VPAAAGGAAAAAEGDGLSLLLFGGVGGEANEVLADPWAFDLKTRAWKPFKSSNTPPARHS 68 VP A E + ++++FGG+ E +E++ + + FD + + W+ + P AR+ Sbjct 231 VPRAFCSGNVITEDNKKNIIIFGGIN-EKDEIVDETYKFDFQAKKWELIGNKICPRARYK 289 Query 69 HAAVYVQQQNKLLIFGGQGEDGRLLKDAYVLEKNTWKALSSASEDLAPSARCCHSGSYCE 128 HA+ + L I GG + LL D + KN+W + D P R HS + Sbjct 290 HASFSFN--DFLYIHGGLDVNNSLLADMWCFSKNSWTPIKQI--DRIPEPRYAHSLIFSF 345 Query 129 IEGRSYVAVFGGDISGTGKGENDLWLYDINQDAW 162 V +FGG+ G D W+++IN + W Sbjct 346 YGNAKLVFLFGGNKKGYNAALGDTWIFNINTNRW 379 Lambda K H 0.316 0.134 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30377245073 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40