bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0794_orf1 Length=168 Score E Sequences producing significant alignments: (Bits) Value 3702.AT2G31450.1 187 8e-47 > 3702.AT2G31450.1 Length=379 Score = 187 bits (476), Expect = 8e-47, Method: Compositional matrix adjust. Identities = 85/170 (50%), Positives = 119/170 (70%), Gaps = 7/170 (4%) Query 5 ERRFAVLVAVMLSSQTKDEQTHACVNRLRENGLLNPYAIAACDPEKLRGLLFGVGFHNNK 64 ERRFAVL+ +LSSQTKD+ +A ++RL +NGLL P A+ D ++ L++ VGF+ K Sbjct 171 ERRFAVLLGALLSSQTKDQVNNAAIHRLHQNGLLTPEAVDKADESTIKELIYPVGFYTRK 230 Query 65 TTFLKEAAEILIKKHKGEVPQTLDDLMQLRGVGRKMANIVMHAAWNSFHGIAVDVHVHRI 124 T++K+ A I + K+ G++P +LDDL+ L G+G KMA++++H AWN GI VD HVHRI Sbjct 231 ATYMKKIARICLVKYDGDIPSSLDDLLSLPGIGPKMAHLILHIAWNDVQGICVDTHVHRI 290 Query 125 SNRLGWV-------KTKTPQETEIALEDCLPRKHWEDVNLLLVGFGQQIC 167 NRLGWV KT +P+ET +AL+ LP++ W +N LLVGFGQ IC Sbjct 291 CNRLGWVSRPGTKQKTTSPEETRVALQQWLPKEEWVAINPLLVGFGQMIC 340 Lambda K H 0.321 0.136 0.415 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30377245073 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40