bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0785_orf2 Length=150 Score E Sequences producing significant alignments: (Bits) Value 5807.cgd8_4740 86.7 2e-16 > 5807.cgd8_4740 Length=267 Score = 86.7 bits (213), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 43/108 (39%), Positives = 59/108 (54%), Gaps = 15/108 (13%) Query 5 GETAEFLHFNVSHDEGLVVFGASRHLVGVDCMRCSPRGSR---------DTTQFLQQMKA 55 E+ LHFNVSHD +VV S+++VG+D M+ SR +FL MK Sbjct 50 SESDSLLHFNVSHDGDVVVIILSKYMVGIDIMKTELSPSRVQLSNNIMEANEKFLNNMKN 109 Query 56 HCTARDWAYIMGVRLPEQQIRRFMRVWTVKEAFVKAIGTGIYIDPERL 103 +W YI ++ I +FM WT+KE+FVK IG G+Y+DP RL Sbjct 110 VFHPSEWEYI------QKDISKFMHYWTIKESFVKYIGLGLYVDPRRL 151 Lambda K H 0.324 0.139 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22764965652 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40