bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eace_0783_orf1 Length=126 Score E Sequences producing significant alignments: (Bits) Value 5833.PF14_0346 209 1e-53 > 5833.PF14_0346 Length=853 Score = 209 bits (533), Expect = 1e-53, Method: Composition-based stats. Identities = 98/126 (77%), Positives = 112/126 (88%), Gaps = 0/126 (0%) Query 1 KVEFKDLQVVRVVGRGTFGTVKLVQHIPTKIRYALKCVSRRSVVALNQQDHIRLEREIMA 60 KVE +L+ R++GRGTFGTVKLV H PTKIRYALKCVS+RS++ LNQQ++I+LEREI A Sbjct 535 KVEMDELETERIIGRGTFGTVKLVHHKPTKIRYALKCVSKRSIINLNQQNNIKLEREITA 594 Query 61 ENDHPFIIRLVRTFRDKDFLYFLTELVTGGELYDAIRKLGLLGRYQAQFYLASIVLAIEY 120 ENDHPFIIRLVRTF+D + YFLTELVTGGELYDAIRKLGLL + QAQFYL SI+LAIEY Sbjct 595 ENDHPFIIRLVRTFKDSKYFYFLTELVTGGELYDAIRKLGLLSKSQAQFYLGSIILAIEY 654 Query 121 LHERNI 126 LHERNI Sbjct 655 LHERNI 660 Lambda K H 0.329 0.145 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 22588795449 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40